PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family YABBY
Protein Properties Length: 188aa    MW: 20906.8 Da    PI: 9.0829
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010231genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY149.23.9e-46101571163
      YABBY   1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssek 100
                +d+++ s+++Cyv+CnfCnt+lav +P   l+ +vtv+CGhC++l  ++ +   q          +    + + l ++++   sn++++ ++++s+s+  
  Cla010231  10 MDLVQPSDHLCYVKCNFCNTLLAVGIPCRRLLDTVTVKCGHCSNLSFLSTRPPLQ---------GQ---CIDHPLSFQSQVGFSNDIRKGASTSSTST-- 95 
                578999*************************************985533333222.........22...23345556666666677777776666666.. PP

      YABBY 101 lsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                 s++  +e+p +  v++PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknWa +
  Cla010231  96 -SSSMPNESPSPNFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY 157
                .5667778888788***********************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.3E-5515157IPR006780YABBY protein
SuperFamilySSF470951.44E-8103155IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.4E-5111156IPR009071High mobility group box domain
CDDcd013903.89E-6118154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSNSEDKSSM DLVQPSDHLC YVKCNFCNTL LAVGIPCRRL LDTVTVKCGH CSNLSFLSTR  60
PPLQGQCIDH PLSFQSQVGF SNDIRKGAST SSTSTSSSMP NESPSPNFVV KPPEKKHRLP  120
SAYNRFMKEE IQRIKAANPE IPHREAFSAA AKNWARYIPN SAAGSVSGTH HNNVRQIIHI  180
YIYIYILI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818967e-49LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132647e-49LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008446454.11e-104PREDICTED: protein CRABS CLAW
RefseqXP_011655718.11e-104PREDICTED: protein CRABS CLAW
SwissprotQ8L9255e-66CRC_ARATH; Protein CRABS CLAW
TrEMBLA0A0A0KQW31e-104A0A0A0KQW3_CUCSA; Uncharacterized protein
STRINGVIT_01s0011g00140.t011e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF102593040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.11e-66YABBY family protein